| Cat.No.: | PE-2479 |
| Product Name: | Recombinant Human MLN51/CASC3 protein |
| Background: | Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Core components of the EJC, that remains bound to spliced mRNAs throughout all stages of mRNA metabolism, functions to mark the position of the exon-exon junction in the mature mRNA and thereby influences downstream processes of gene expression including mRNA splicing, nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Stimulates the ATPase and RNA-helicase activities of EIF4A3. Plays a role in the stress response by participating in cytoplasmic stress granules assembly and by favouring cell recovery following stress. Component of the dendritic ribonucleoprotein particles (RNPs) in hippocampal neurons (By similarity). May play a role in mRNA transport (By similarity). Binds spliced mRNA in sequence-independent manner, 20-24 nucleotides upstream of mRNA exon-exon junctions. Binds poly(G) and poly(U) RNA homopolymer. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | Barentsz/Barentsz protein/Btz |
| Tag: | GST |
| Amino Acid Sequence: | VSMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYPN TQAPSQVYGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSRGSS |
| Sequence Similarities: | Belongs to the CASC3 family. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | ADP-ribosylated by tankyrase TNKS and TNKS2. Poly-ADP-ribosylated protein is recognized by RNF146, followed by ubiquitination.Ubiquitinated by RNF146 when poly-ADP-ribosylated, leading to its degradation. |
| Protein Length: | Protein fragment; 604 to 703 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Synthetic Peptides | ||
| SP-0008 | PRMT4 peptide substrate, Biotin-labeled | Inquiry |
| ◆ Cell Lines | ||
| CL-0050 | Human CARM1 Knockout Cell Line 8bp deletion | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0123 | Ellagic acid | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0134 | Recombinant Human CARM1 293 Cell Lysate | Inquiry |
| EL-0148 | Recombinant Human CAMTA2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| CABIN1 | CAF1 | CAMKIV | CAMTA2 |
| CAPNS2 | CARHSP1 | CARM1 | CASC3 |
| CASP | CASP1 | CASP3 | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
