| Cat.No.: | PE-2473 |
| Product Name: | Recombinant Human Kaiso protein |
| Background: | Transcriptional regulator with bimodal DNA-binding specificity. Binds to methylated CpG dinucleotides in the consensus sequence 5'-CGCG-3' and also binds to the non-methylated consensus sequence 5'-CTGCNA-3'. Recruits the N-CoR repressor complex to promote histone deacetylation and the formation of repressive chromatin structures in target gene promoters. May contribute to the repression of target genes of the Wnt signaling pathway. May also activate transcription of a subset of target genes by the recruitment of CTNND2. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | Kaiso/Kaiso protein/Kaiso transcription factor |
| Tag: | GST |
| Amino Acid Sequence: | QFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKD DGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGST EFEFIIPESY |
| Sequence Similarities: | Contains 1 BTB (POZ) domain.Contains 3 C2H2-type zinc fingers. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 564 to 673 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0073 | Anacardic Acid | Inquiry |
| ◆ Antibodies | ||
| EAb-0073 | KAT8 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0083 | Human KAT2A Knockout Cell Line 1bp insertion | Inquiry |
| CL-0085 | Human KAT2B Knockout Cell Line 31bp deletion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0159 | Recombinant Human MYST2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| Kaiso | KANSL2 | KAP1 | KAT13A |
| KAT13D | KAT2A | KAT2B | KAT4 |
| KAT5 | KAT6A | KAT6B | KAT7 |
| KAT8 | KAT9 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
