Recombinant Human PRDM5 protein

Cat.No.:	PE-2397
Product Name:	Recombinant Human PRDM5 protein
Background:	Sequence-specific DNA-binding transcription factor. Represses transcription at least in part by recruitment of the histone methyltransferase EHMT2/G9A and histone deacetylases such as HDAC1. Regulates hematopoiesis-associated protein-coding and microRNA (miRNA) genes.
Applications:	ELISA; Western blot; SDS-PAGE
Storage:	Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:	Liquid
Molecular Weight:	39 kDa including tags
Species:	Human
Formulation:	pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Accession#:	Q9NQX1-3
Alternative Names:	BCS2/PFM 2/PFM2
Amino Acid Sequence:	MLGMYVPDRFSLKSSRVQDGMGLYTARRVRKGEKFGPFAGEKRMPEDLDE NMDYRLMWEVRGSKGEVLYILDATNPRHSNWLRFVHEAPSQEQKNLAAIQ DKNLGPAEWRG
Sequence Similarities:	Contains 16 C2H2-type zinc fingers.Contains 1 SET domain.
Expression System:	Wheat germ
Protein Length:	Full length protein; 1 to 111
Warning:	This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Products