Cat.No.: | PE-2386 |
Product Name: | Recombinant Human Elp4 protein |
Background: | Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4. |
Applications: | Western blot; ELISA |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | C11orf19/dJ68P15A.1/Elongation protein 4 homolog |
Tag: | GST |
Amino Acid Sequence: | YFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHK TPESNIKMKIAWRYQLLPKMEIGPVSSSRFGHYYDASKRMPQELIEASN |
Sequence Similarities: | Belongs to the ELP4 family. |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 101 to 199 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0191 | Recombinant Human ELP3 Cell Lysate | Inquiry |
EL-0199 | Recombinant Human ELP2 293 Cell Lysate | Inquiry |
◆ Antibodies | ||
EAb-0314 | ELAVL3 Polyclonal Antibody | Inquiry |
EAb-1079 | ELP3 Polyclonal Antibody, HRP Conjugated | Inquiry |
EAb-1082 | ELP3 Polyclonal Antibody, FITC Conjugated | Inquiry |
Related Gene / Proteins | |||
ELAVL3 | ELE1 | Elk-1 | ELP2 |
ELP3 | ELP4 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools