| Cat.No.: | PE-2352 |
| Product Name: | Recombinant Human APOBEC3F protein |
| Background: | DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms. Exhibits antiviral activity against vif-deficient HIV-1. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA. The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single- or double-stranded RNA. Exhibits antiviral activity also against hepatitis B virus (HBV), equine infectious anemia virus (EIAV), xenotropic MuLV-related virus (XMRV) and simian foamy virus (SFV) and may inhibit the mobility of LTR and non-LTR retrotransposons. May also play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation. |
| Applications: | SDS-PAGE; Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 38 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Accession#: | Q8IUX4-3 |
| Alternative Names: | A3F/ABC3F_HUMAN/APOBEC3F |
| Amino Acid Sequence: | MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLD AKIFRGQVPRSFIRAPFQVLSSPFGQCAPPHGTAQVQWPPQLTAGREQGR P |
| Sequence Similarities: | Belongs to the cytidine and deoxycytidylate deaminase family.Contains 2 CMP/dCMP-type deaminase domains. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 101 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0374 | APOBEC3D Polyclonal Antibody | Inquiry |
| EAb-0375 | APOBEC2 Polyclonal Antibody | Inquiry |
| EAb-0393 | APOBEC3G Polyclonal Antibody | Inquiry |
| EAb-0403 | APOBEC3C Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0388 | Human APTX Knockout Cell Line 11bp deletion | Inquiry |
| Related Gene / Proteins | |||
| AP-2 | Ape1 | APOBEC2 | APOBEC3A |
| APOBEC3B | APOBEC3C | APOBEC3D | APOBEC3F |
| APOBEC3G | APOBEC3H | APOBEC4 | APTX |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
