| Cat.No.: | PE-2347 |
| Product Name: | Recombinant Human Chd1 protein |
| Background: | ATP-dependent chromatin-remodeling factor which functions as substrate recognition component of the transcription regulatory histone acetylation (HAT) complex SAGA. Regulates polymerase II transcription. Also required for efficient transcription by RNA polymerase I, and more specifically the polymerase I transcription termination step. Regulates negatively DNA replication. Not only involved in transcription-related chromatin-remodeling, but also required to maintain a specific chromatin configuration across the genome. Is also associated with histone deacetylase (HDAC) activity (By similarity). Required for the bridging of SNF2, the FACT complex, the PAF complex as well as the U2 snRNP complex to H3K4me3. Functions to modulate the efficiency of pre-mRNA splicing in part through physical bridging of spliceosomal components to H3K4me3. Required for maintaining open chromatin and pluripotency in embryonic stem cells. |
| Applications: | ELISA; Western blot; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 36 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.3% Glutathione, 0.79% Tris HCl |
| Accession#: | O14646 |
| Alternative Names: | ATP dependent helicase CHD 1/ATP-dependent helicase CHD1/CHD 1 |
| Amino Acid Sequence: | IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHK SIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS |
| Sequence Similarities: | Belongs to the SNF2/RAD54 helicase family.Contains 2 chromo domains.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 1177 to 1272 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0147 | Recombinant Human CHAF1A 293 Cell Lysate | Inquiry |
| EL-0167 | Recombinant Human CHAF1B 293 Cell Lysate | Inquiry |
| EL-0211 | Recombinant Human CHD2 Cell Lysate | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0180 | Mouse Chd7 peptide | Inquiry |
| ◆ Antibodies | ||
| EAb-0199 | CHRDL1 Monoclonal Antibody (3H1-F6-A10) | Inquiry |
| Related Gene / Proteins | |||
| CHAF1A | CHAF1B | CHD1 | CHD2 |
| CHD3 | CHD4 | CHD5 | Chd7 |
| CHD8 | CHD9 | CHEK2 | CHRAC1 |
| CHRDL1 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
