| Cat.No.: | PE-2344 |
| Product Name: | Recombinant Human Ctip1/BCL-11A protein |
| Background: | Functions as a myeloid and B-cell proto-oncogene. May play important roles in leukemogenesis and hematopoiesis. An essential factor in lymphopoiesis, is required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1. |
| Applications: | SDS-PAGE; Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 35 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.79% Tris HCl, 0.31% Glutathione |
| Accession#: | Q9H165 |
| Alternative Names: | 2810047E18Rik/B cell CLL/lymphoma 11A (zinc finger protein)/B cell CLL/lymphoma 11A (zinc finger protein) isoform 2 |
| Amino Acid Sequence: | MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQ CQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS |
| Sequence Similarities: | Contains 6 C2H2-type zinc fingers. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Sumoylated by SUMO1. |
| Protein Length: | Protein fragment; 1 to 88 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0087 | Recombinant Human BCOR 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0708 | Recombinant Human BCOR, GST-tagged | Inquiry |
| PE-0709 | Recombinant Zebrafish BCOR | Inquiry |
| PE-0710 | Recombinant Mouse BCOR Protein | Inquiry |
| PE-0711 | Recombinant Human BCOR Protein, GST-tagged | Inquiry |
| Related Gene / Proteins | |||
| Bcl10 | BCL11A | Bcl3 | Bcl6 |
| BCOR | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
