Recombinant Human Ctip1/BCL-11A protein


  • Specification
  • Related Products
Cat.No.:  PE-2344
Product Name:  Recombinant Human Ctip1/BCL-11A protein
Background:  Functions as a myeloid and B-cell proto-oncogene. May play important roles in leukemogenesis and hematopoiesis. An essential factor in lymphopoiesis, is required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1.
Applications:  SDS-PAGE; Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  35 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.79% Tris HCl, 0.31% Glutathione
Accession#:  Q9H165
Alternative Names:  2810047E18Rik/B cell CLL/lymphoma 11A (zinc finger protein)/B cell CLL/lymphoma 11A (zinc finger protein) isoform 2
Amino Acid Sequence:  MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQ CQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS
Sequence Similarities:  Contains 6 C2H2-type zinc fingers.
Expression System:  Wheat germ
Post Translational Modifications:  Sumoylated by SUMO1.
Protein Length:  Protein fragment; 1 to 88
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.