Recombinant Human PRDM1/Blimp1 protein


  • Specification
  • Related Products
Cat.No.:  PE-2333
Product Name:  Recombinant Human PRDM1/Blimp1 protein
Background:  Transcriptional repressor that binds specifically to the PRDI element in the promoter of the beta-interferon gene (PubMed:1851123). Drives the maturation of B-lymphocytes into Ig secreting cells (PubMed:12626569).
Applications:  SDS-PAGE; Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  38 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Accession#:  O75626-2
Alternative Names:  B Lymphocyte Induced Maturation Protein 1/Beta interferon gene positive regulatory domain I binding factor/Beta-interferon gene positive regulatory domain I-binding factor
Amino Acid Sequence:  MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRN LLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFW RIYSRGELH
Sequence Similarities:  Belongs to the class V-like SAM-binding methyltransferase superfamily.Contains 4 C2H2-type zinc fingers.Contains 1 SET domain.
Expression System:  Wheat germ
Post Translational Modifications:  Sumoylation at Lys-816 by PIAS1 augments transcriptional repressor activity, and is critical for plasma cell differentiation.Ubiquitinated by the SCF(FBXO11) complex, leading to its degradation by the proteasome.
Protein Length:  Protein fragment; 1 to 109
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.