| Cat.No.: | PE-2328 |
| Product Name: | Recombinant Human Metnase protein |
| Background: | Histone methyltransferase that methylates 'Lys-4' and 'Lys-36' of histone H3, 2 specific tags for epigenetic transcriptional activation. Specifically mediates dimethylation of H3 'Lys-36'. Has sequence-specific DNA-binding activity and recognizes the 19-mer core of the 5'-terminal inverted repeats (TIRs) of the Hsmar1 element. Has DNA nicking activity. Has in vivo end joining activity and may mediate genomic integration of foreign DNA. |
| Applications: | ELISA; Western blot; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 66 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Accession#: | Q53H47-2 |
| Alternative Names: | Histone lysine N methyltransferase/Histone lysine N methyltransferase SETMAR/Hsmar 1 |
| Amino Acid Sequence: | MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGA DIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAE PVFECNVLCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGR FVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVYNGQVMETFVDPT YIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYS GRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI SCGNEKEPSMCGSAPSVFPSCKRLTLEVSLFSDKQLAPPYSGRQWLASFT SA |
| Sequence Similarities: | In the N-terminal section; belongs to the histone-lysine methyltransferase family.In the C-terminal section; belongs to the mariner transposase family.Contains 1 post-SET domain.Contains 1 pre-SET domain.Contains 1 SET domain. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 352 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0043 | Recombinant Human MECP2 293 Cell Lysate | Inquiry |
| EL-0111 | Recombinant Human MEF2B Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0067 | MeCP2 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0109 | Human MECP2 Knockout Cell Line 1bp insertion | Inquiry |
| CL-0110 | Human MEN1 Knockout Cell Line 1bp insertion | Inquiry |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
