Cat.No.: | PE-2319 |
Product Name: | Recombinant Human ING3 protein |
Background: | Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome. Tissue specificity: Expressed in brain, heart, kidney, liver, lung, ovaries, placenta, prostate, skeletal muscle, small intestine, spleen, testis and thymus. Disease: Squamous cell carcinoma of the head and neck Similarity: Belongs to the ING family. Contains 1 PHD-type zinc finger. Domain: The PHD-type zinc finger mediates the binding to H3K4me3. |
Applications: | ELISA; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | 1300013A07Rik/Eaf 4/Eaf4 |
Tag: | GST |
Amino Acid Sequence: | MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNA KKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF |
Expression System: | Wheat germ |
Protein Length: | Full length protein; 1 to 92 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0182 | Recombinant Human ING5 293 Cell Lysate | Inquiry |
EL-0189 | Recombinant Human ING3 293 Cell Lysate | Inquiry |
EL-0196 | Recombinant Human ING4 293 Cell Lysate | Inquiry |
◆ Antibodies | ||
EAb-0317 | ING4 Polyclonal Antibody | Inquiry |
◆ Cell Lines | ||
CL-0403 | Human INSL6 Knockout Cell Line | Inquiry |
Related Gene / Proteins | |||
ING1 | ING2 | ING3 | ING4 |
ING5 | INHAT-1 | INHAT-2 | Ini1 |
INSL6 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools