| Cat.No.: | PE-2317 |
| Product Name: | Recombinant Human ING1 protein |
| Background: | Cooperates with p53/TP53 in the negative regulatory pathway of cell growth by modulating p53-dependent transcriptional activation. Implicated as a tumor suppressor gene. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | 2610028J21Rik/AA407184/AI875420 |
| Tag: | GST |
| Amino Acid Sequence: | DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQ IVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA |
| Sequence Similarities: | Belongs to the ING family.Contains 1 PHD-type zinc finger. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 41 to 140 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0182 | Recombinant Human ING5 293 Cell Lysate | Inquiry |
| EL-0189 | Recombinant Human ING3 293 Cell Lysate | Inquiry |
| EL-0196 | Recombinant Human ING4 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0317 | ING4 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0403 | Human INSL6 Knockout Cell Line | Inquiry |
| Related Gene / Proteins | |||
| ING1 | ING2 | ING3 | ING4 |
| ING5 | INHAT-1 | INHAT-2 | Ini1 |
| INSL6 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
