Recombinant Human MSL2L1 protein


  • Specification
  • Related Products
Cat.No.:  PE-2293
Product Name:  Recombinant Human MSL2L1 protein
Background:  Component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at lysine 16 which is implicated in the formation of higher-order chromatin structure.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  Male specific lethal 2 homolog/Male specific lethal 2 homolog (Drosophila)/Male specific lethal 2 homolog 1
Tag:  GST
Amino Acid Sequence:  GQRCPCYSNRKACLDCICRGCQNSYMANGEKKLEAFAVPEKALEQTRLTL GINVTSIAVRNASTSTSVINVTGSPVTTFLAASTHDDKSLDEAIDMRF
Sequence Similarities:  Belongs to the MSL2 family.Contains 1 RING-type zinc finger.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 478 to 575
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.