| Cat.No.: | PE-2290 |
| Product Name: | Recombinant Human NARG1 protein |
| Background: | The NAA10-NAA15 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. Required to control retinal neovascularization in adult ocular endothelial cells. In complex with XRCC6 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | 5730450D16Rik/6330400I15/ASTBDN |
| Tag: | GST |
| Amino Acid Sequence: | HRLSAAKMVYYLDPSSQKRAIELATTLDESLTNRNLQTCMEVLEALYDGS LGDCKEAAEIYRANCHKLFPYALAFMPPGYEEDMKITVNGDSSAEAEEL |
| Sequence Similarities: | Contains 8 TPR repeats. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Cleaved by caspases during apoptosis, resulting in a stable 35 kDa fragment. |
| Protein Length: | Protein fragment; 764 to 862 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0040 | FK-866 HCl | Inquiry |
| BSM-0201 | Remodelin | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0051 | Recombinant Human NACC2 Cell Lysate | Inquiry |
| EL-0085 | Recombinant Human NAP1L2 293 Cell Lysate | Inquiry |
| EL-0158 | Recombinant Human NASP 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| NAA38 | NAA60 | NACC2 | Nampt |
| Nanog | Nanos3 | Nap1 | NAP1L1 |
| NAP1L2 | NAP1L4 | NARG1 | NASP |
| NAT10 | NAT14 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
