Recombinant Human PRDM3 protein


  • Specification
  • Related Products
Cat.No.:  PE-2275
Product Name:  Recombinant Human PRDM3 protein
Background:  PRDM3 can be produced either as a separate transcript and as a fusion transcript with EVI1. A chromosomal aberration involving PRDM3 is found in a form of acute myeloid leukemia. The myelodysplastic syndromes (MDS, formerly known as "preleukemia") are a diverse collection of hematological conditions united by ineffective production of blood cells and varying risks of transformation to acute myelogenous leukemia.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  MDS1/MDS1 EVI1/MDS1EVI1
Tag:  GST
Amino Acid Sequence:  MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPA TSSEAFTPKEGSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKI EVGEKFGPYVGEQRSNLKDPSYGWEVHLPRSRRVSVHSWLYLGKRSSDVG IAFSQADVYMPGLQCAFLS
Expression System:  Wheat germ
Protein Length:  Full length protein; 1 to 169
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.