Recombinant human PRMT1 protein (Active)


  • Specification
  • Related Products
Cat.No.:  PE-2273
Product Name:  Recombinant human PRMT1 protein (Active)
Background:  Arginine methyltransferase that methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in proteins such as ESR1, histone H2, H3 and H4, PIAS1, HNRNPA1, HNRNPD, NFATC2IP, SUPT5H, TAF15 and EWS. Constitutes the main enzyme that mediates monomethylation and asymmetric dimethylation of histone H4 'Arg-4' (H4R3me1 and H4R3me2a, respectively), a specific tag for epigenetic transcriptional activation. Together with dimethylated PIAS1, represses STAT1 transcriptional activity, in the late phase of interferon gamma (IFN-gamma) signaling. May be involved in the regulation of TAF15 transcriptional activity, act as an activator of estrogen receptor (ER)-mediated transactivation, play a key role in neurite outgrowth and act as a negative regulator of megakaryocytic differentiation, by modulating p38 MAPK pathway.
Applications:  Functional Studies; SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  68 kDa including tags
Purity:  >68 % SDS-PAGE.
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.63% Tris HCl, 1.74% Sodium chloride, 20% Glycerol, 0.02% DTT
Accession#:  NM_001536
Alternative Names:  ANM 1/ANM1/ANM1_HUMAN
Tag:  GST
Amino Acid Sequence:  AAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKD YYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGI LCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVEL PVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVT AIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACL IKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGF STSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTI DLDFKGQLCELSCSTDYRMR
Sequence Similarities:  Belongs to the protein arginine N-methyltransferase family.
Expression System:  Sf9 Insect Cells
Protein Length:  Full length protein; 2 to 371
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.