Recombinant Human USP34 protein

Cat.No.:	PE-2250
Product Name:	Recombinant Human USP34 protein
Background:	Ubiquitin hydrolase that can remove conjugated ubiquitin from AXIN1 and AXIN2, thereby acting as a regulator of Wnt signaling pathway. Acts as an activator of the Wnt signaling pathway downstream of the beta-catenin destruction complex by deubiquitinating and stabilizing AXIN1 and AXIN2, leading to promote nuclear accumulation of AXIN1 and AXIN2 and positively regulate beta-catenin (CTNBB1)-mediated transcription. Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquinated proteins.
Applications:	ELISA; Western blot
Storage:	Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:	Liquid
Species:	Human
Formulation:	pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:	Deubiquitinating enzyme 34/FLJ43910/KIAA0570
Tag:	GST
Amino Acid Sequence:	CKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDGQALPSQDP EVALSLSCGHSRGLFSHMQQHDILDTLCRTIESTIHVVTRISGKGNQAAS
Sequence Similarities:	Belongs to the peptidase C19 family.
Expression System:	Wheat germ
Post Translational Modifications:	Phosphorylated upon DNA damage, probably by ATM or ATR.
Protein Length:	Protein fragment; 3296 to 3395
Warning:	This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Products