| Cat.No.: | PE-2218 |
| Product Name: | Recombinant Human DCTD protein |
| Background: | Supplies the nucleotide substrate for thymidylate synthetase. |
| Applications: | Mass Spectrometry; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 22 kDa including tags |
| Purity: | > 90 % SDS-PAGE. Purified using conventional chromatography techniques. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride |
| Accession#: | P32321 |
| Alternative Names: | dCMP deaminase/dctD/DCTD_HUMAN |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMSEVSCKKRDDYLEWPEYFMAVAFLSAQRS KDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYP YVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSD KYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ |
| Sequence Similarities: | Belongs to the cytidine and deoxycytidylate deaminase family. |
| Expression System: | E. coli |
| Protein Length: | Full length protein; 1 to 178 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0405 | Human DCLRE1C Knockout Cell Line 4bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-1406 | DCUN1D2 Polyclonal Antibody, HRP Conjugated | Inquiry |
| EAb-1408 | DCUN1D2 Polyclonal Antibody, Biotin Conjugated | Inquiry |
| EAb-1409 | DCUN1D2 Polyclonal Antibody, FITC Conjugated | Inquiry |
| EAb-1410 | DCUN1D1 Polyclonal Antibody, HRP Conjugated | Inquiry |
| Related Gene / Proteins | |||
| DCAF4 | DCLRE1C | Dcp2 | DCTD |
| DCUN1D1 | DCUN1D2 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
