| Cat.No.: | PE-2164 |
| Product Name: | Recombinant Human Ssu72 protein |
| Background: | May be involved in the C-terminal domain of RNA polymerase II dephosphorylation, RNA processing and termination. |
| Applications: | Mass Spectrometry; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 25 kDa including tags |
| Purity: | > 95 % SDS-PAGE. Purified using conventional chromatography. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride |
| Accession#: | Q9NP77 |
| Alternative Names: | CTD phosphatase SSU72/HSPC182/Hypothetical protein FLJ10947 |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMGSMPSSPLRVAVVCSSNQNRSMEAHNILS KRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYT QNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSRE QETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQ EFEEKSGRTFLHTVCFY |
| Sequence Similarities: | Belongs to the SSU72 phosphatase family. |
| Expression System: | E. coli |
| Protein Length: | Full length protein; 1 to 194 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0067 | Recombinant Human SSRP1 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0574 | Recombinant Human SSRP1, His-tagged | Inquiry |
| PE-0575 | Recombinant Chicken SSRP1 | Inquiry |
| PE-0576 | Recombinant Rat SSRP1 Protein | Inquiry |
| PE-0577 | Recombinant Rhesus monkey SSRP1 Protein, His-tagged | Inquiry |
| Related Gene / Proteins | |||
| SSBP4 | SSRP1 | Ssu72 | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
