| Cat.No.: | PE-2162 |
| Product Name: | Recombinant Human TRIM37/MUL protein |
| Background: | E3 ubiquitin-protein ligase. |
| Applications: | ELISA; Western blot; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 37 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.3% Glutathione, 0.79% Tris HCl |
| Accession#: | O94972 |
| Alternative Names: | E3 ubiquitin protein ligase TRIM37/E3 ubiquitin-protein ligase TRIM37/KIAA0898 |
| Amino Acid Sequence: | GHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGMSSDSDIECDTENEE QEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDENSGR |
| Sequence Similarities: | Belongs to the TRIM/RBCC family.Contains 1 B box-type zinc finger.Contains 1 MATH domain.Contains 1 RING-type zinc finger. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Auto-ubiquitinated. |
| Protein Length: | Protein fragment; 865 to 964 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0018 | Danusertib (PHA-739358) | Inquiry |
| BSM-0021 | PF-03814735 | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0107 | Recombinant Human TRIM68 293 Cell Lysate | Inquiry |
| EL-0109 | Recombinant Human TRIP4 Lysate | Inquiry |
| EL-0115 | Recombinant Human TRIM24 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| MUL | TRA2A | TRAF4 | TRAF5 |
| TRAF6 | TRAK2 | TRBP | TRDMT1 |
| TREX1 | TRF2 | TRIM11 | TRIM13 |
| TRIM16 | TRIM17 | TRIM2 | TRIM21 |
| trim24 | TRIM26 | TRIM28 | TRIM3 More > |
| TRIM33 | TRIM34 | TRIM35 | TRIM36 |
| TRIM37 | TRIM38 | TRIM39 | TRIM4 |
| TRIM5 | TRIM55 | TRIM6 | TRIM63 |
| TRIM66 | TRIM68 | TRIM8 | TRIM9 |
| TRIML1 | TRIP4 | Tristetraprolin | TRIT1 |
| TrkA | TRMT2A | TRMT44 | TRMT5 |
| TRMT6 | TROVE2 | TRUB2 | TRX1 |
| TRβ1 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
