Recombinant Human A3H protein


  • Specification
  • Related Products
Cat.No.:  PE-2154
Product Name:  Recombinant Human A3H protein
Background:  ARP10 belongs to the cytidine and deoxycytidylate deaminase family. It is a poorly expressed deaminase that is ineffective at inhibiting retroviral replication. ARP10 has DNA deaminase (cytidine deaminase) activity but is not able to mediate G-to-A hypermutation in newly synthesized retroviral DNA. It is present at low level in 293T cells. It is considered an unstable protein, suggesting that it may be degraded by the proteasome (at protein level). Weakly expressed in testis, ovary, fetal liver and skin. There are two named isoforms. ARP10 from old world monkeys has retained its antiviral activity, while it is lost in other primates. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  A3H/APOBEC related protein 10/APOBEC3H
Tag:  GST
Amino Acid Sequence:  MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENK KKCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHD HLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVD HEKPLSFNPYKMLEELDKNSRAIKRRLERIKS
Expression System:  Wheat germ
Protein Length:  Full length protein; 1 to 182
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.