| Cat.No.: | PE-2133 |
| Product Name: | Recombinant Human Reptin/TIP49B/RUVB2 protein (His tag) |
| Background: | Possesses single-stranded DNA-stimulated ATPase and ATP-dependent DNA helicase (5' to 3') activity. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. RUVBL2 plays an essential role in oncogenic transformation by MYC and also modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex. May also inhibit the transcriptional activity of ATF2. |
| Applications: | SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 67 kDa including tags |
| Purity: | > 90 % SDS-PAGE. |
| Species: | Human |
| Formulation: | Constituents: 50% Glycerol, Tris buffer |
| Accession#: | Q9Y230 |
| Alternative Names: | 48 kDa TATA box-binding protein-interacting protein/48 kDa TBP-interacting protein/48-kDa TATA box-binding protein-interacting protein |
| Tag: | His |
| Amino Acid Sequence: | ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLA ARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFT AIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPA TGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGK ISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVIN SRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEV HMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLL DRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRY AIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFL FNELKGETMDTS |
| Sequence Similarities: | Belongs to the ruvB family. |
| Expression System: | E. coli |
| Post Translational Modifications: | Phosphorylated upon DNA damage, probably by ATM or ATR. |
| Protein Length: | Full length protein; 2 to 463 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0014 | TIP60 Polyclonal Antibody | Inquiry |
| EAb-0015 | TIP60 Polyclonal Antibody | Inquiry |
| EAb-0042 | Runx1/AML1-ETO Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0092 | Recombinant Human RUNX2 293 Cell Lysate | Inquiry |
| EL-0093 | Recombinant Human RUNX2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| RECQL4 | rela | Reptin | REST |
| REXO5 | Runx1 | RUNX2 | RUVB2 |
| RUVBL1 | TIAL1 | TIEG1 | TIF1 |
| TIGD4 | TIGD5 | TIP49A | TIP49B |
| TIP60 | TIS11D | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
