Cat.No.: | PE-2065 |
Product Name: | Recombinant Mouse HDAC8 protein |
Background: | Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. May play a role in smooth muscle cell contractility. |
Applications: | SDS-PAGE |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 43 kDa including tags |
Purity: | > 90 % SDS-PAGE. Purified by using conventional chromatography techniques. |
Species: | Mouse |
Formulation: | pH: 7.4; Constituents: 10% Glycerol, 90% PBS |
Accession#: | Q8VH37 |
Alternative Names: | CDA07/CDLS5/HD 8 |
Tag: | His |
Amino Acid Sequence: | MEMPEEPANSGHSLPPVYIYSPEYVSICDSLVKVPKRASMVHSLIEAYAL HKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDEDHPDSIEYGLGY DCPATEGIFDYAAAIGGGTITAAQCLIDGKCKVAINWSGGWHHAKKDEAS GFCYLNDAVLGILRLRRKFDRILYVDLDLHHGDGVEDAFSFTSKVMTVSL HKFSPGFFPGTGDMSDVGLGKGRYYSVNVPIQDGIQDEKYYHICESVLKE VYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYVLQWQLATLI LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITP SCRPDRNEPHRIQQILNYIKGNLKHVV |
Sequence Similarities: | Belongs to the histone deacetylase family. HD type 1 subfamily. |
Expression System: | Baculovirus-Insect Cells |
Post Translational Modifications: | Phosphorylated by PKA on serine 39. Phosphorylation reduces deacetylase activity observed preferentially on histones H3 and H4. |
Protein Length: | Full length protein; 1 to 377 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0006 | Recombinant Human HDAC1 293 Cell Lysate | Inquiry |
EL-0007 | Recombinant Human HDAC2 293 Cell Lysate | Inquiry |
EL-0008 | Recombinant Human HDAC3 Cell Lysate | Inquiry |
EL-0009 | Recombinant Human HDAC4 Cell Lysate | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0007 | Tubacin | Inquiry |
Related Gene / Proteins | |||
HDAC | HDAC1 | HDAC10 | HDAC11 |
HDAC2 | HDAC3 | hdac4 | hdac5 |
HDAC6 | hdac7 | HDAC8 | hdac9 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools