Recombinant Human MFAP5 Full Length protein, His tagged
Cat.No. : | MFAP5-8554H |
Product Overview : | Recombinant Human MFAP5 protein(Ile22-Leu173), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Ile22-Leu173 |
Tag : | C-His |
Form : | Liquid in sterile PBS, pH7.4. |
Molecular Mass : | The recombinant human MFAP5 comprises 163 amino acids and has a predicted molecular mass of 18.7 kDa. The apparent molecular mass of the protein is approximately 54 and 29 kDa in SDS-PAGE under reducing conditions. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 80% as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.0 mg/ml. |
Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGLAHHHHHHHHHH |
Gene Name | MFAP5 microfibrillar associated protein 5 [ Homo sapiens ] |
Official Symbol | MFAP5 |
Synonyms | MFAP5; microfibrillar associated protein 5; microfibrillar-associated protein 5; MAGP2; MP25; MAGP-2; MFAP-5; microfibril-associated glycoprotein 2; microfibril-associated glycoprotein-2; |
Gene ID | 8076 |
mRNA Refseq | NM_003480 |
Protein Refseq | NP_003471 |
MIM | 601103 |
UniProt ID | Q13361 |
◆ Recombinant Proteins | ||
MFAP5-4437H | Recombinant Human MFAP5 protein, His-SUMO-tagged | +Inquiry |
Mfap5-4055M | Recombinant Mouse Mfap5 Protein, Myc/DDK-tagged | +Inquiry |
Mfap5-292R | Recombinant Rat Mfap5 Protein, His-tagged | +Inquiry |
Mfap5-316M | Active Recombinant Mouse Mfap5, His-tagged | +Inquiry |
Mfap5-291M | Recombinant Mouse Mfap5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFAP5-1395HCL | Recombinant Human MFAP5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MFAP5 Products
Required fields are marked with *
My Review for All MFAP5 Products
Required fields are marked with *
0
Inquiry Basket